INSERT INTO sites(host) VALUES('eenadupellipandiri.net') 1045: Access denied for user 'www-data'@'localhost' (using password: NO) eenadupellipandiri.net Estimated Worth $485,469 - MYIP.NET Website Information
Welcome to MyIP.net!
 Set MYIP as homepage      

  
           

Web Page Information

Title:
Meta Description:
Meta Keywords:
sponsored links:
Links:
Images:
Age:
sponsored links:

Traffic and Estimation

Traffic:
Estimation:

Website Ranks

Alexa Rank:
Google Page Rank:
Sogou Rank:
Baidu Cache:

Search Engine Indexed

Search EngineIndexedLinks
 Google:
 Bing:
 Yahoo!:
 Baidu:
 Sogou:
 Youdao:
 Soso:

Server Data

Web Server:
IP address:    
Location:

Registry information

Registrant:
Email:
ICANN Registrar:
Created:
Updated:
Expires:
Status:
Name Server:
Whois Server:

Alexa Rank and trends

Traffic: Today One Week Avg. Three Mon. Avg.
Rank:
PV:
Unique IP:

More ranks in the world

Users from these countries/regions

Where people go on this site

Alexa Charts

Alexa Reach and Rank

Whois data

Who is eenadupellipandiri.net at net.whois-servers.net

Domain Name: EENADUPELLIPANDIRI.NET

Registry Domain ID: 1223460129_DOMAIN_NET-VRSN

Registrar WHOIS Server: whois.networksolutions.com

Registrar URL: http://networksolutions.com

Updated Date: 2016-09-26T12:25:15Z

Creation Date: 2007-09-18T06:51:14Z

Registry Expiry Date: 2020-09-18T06:51:14Z

Registrar: Network Solutions, LLC.

Registrar IANA ID: 2

Registrar Abuse Contact Email: abuse

Registrar Abuse Contact Phone: +1.8003337680

Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited

Name Server: dns1.cloudns.net

Name Server: dns2.cloudns.net

Name Server: dns5.cloudns.net

Name Server: dns6.cloudns.net

DNSSEC: unsigned

URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

>>> Last update of whois database: 2018-11-01T14:22:11Z <<<



For more information on Whois status codes, please visit https://icann.org/epp



NOTICE:
The expiration date displayed in this record is the date the

registrar's sponsorship of the domain name registration in the registry is

currently set to expire. This date does not necessarily reflect the expiration

date of the domain name registrant's agreement with the sponsoring

registrar. Users may consult the sponsoring registrar's Whois database to

view the registrar's reported date of expiration for this registration.



TERMS OF USE:
You are not authorized to access or query our Whois

database through the use of electronic processes that are high-volume and

automated except as reasonably necessary to register domain names or

modify existing registrations; the Data in VeriSign Global Registry

Services' ("VeriSign") Whois database is provided by VeriSign for

information purposes only, and to assist persons in obtaining information

about or related to a domain name registration record. VeriSign does not

guarantee its accuracy. By submitting a Whois query, you agree to abide

by the following terms of use: You agree that you may use this Data only

for lawful purposes and that under no circumstances will you use this Data

to:
(1) allow, enable, or otherwise support the transmission of mass

unsolicited, commercial advertising or solicitations via e-mail, telephone,

or facsimile; or (2) enable high volume, automated, electronic processes

that apply to VeriSign (or its computer systems). The compilation,

repackaging, dissemination or other use of this Data is expressly

prohibited without the prior written consent of VeriSign. You agree not to

use electronic processes that are automated and high-volume to access or

query the Whois database except as reasonably necessary to register

domain names or modify existing registrations. VeriSign reserves the right

to restrict your access to the Whois database in its sole discretion to ensure

operational stability. VeriSign may restrict or terminate your access to the

Whois database for failure to abide by these terms of use. VeriSign

reserves the right to modify these terms at any time.



The Registry database contains ONLY .COM, .NET, .EDU domains and

Registrars.

Front Page Thumbnail

sponsored links:

Front Page Loading Time

Keyword Hits (Biger,better)

Other TLDs of eenadupellipandiri

TLDs Created Expires Registered
.com
.net
.org
.cn
.com.cn
.asia
.mobi

Similar Websites

More...
Alexa鏍囬

Search Engine Spider Emulation

Title:Matrimony-Telugu Matrimonial | Indian Matrimonial Site | Matrimonial Search | Eenadu Pellipandiri
Description:Eenadupellipandiri.net - The Top & Most Successful Indian Matrimonial Website. Trusted by millions of Indian Brides & Grooms globally. Register FREE!
Keywords:Matrimonial, Matrimony, Indian Matrimonial,Telugu Matrimonial, Telugu Matrimonials, Telugu Matrimony,Quick Matrimonial Search, Search Matrimony Profiles, Search Bride Profiles, Search Groom Profiles, Community Search, Location Search, Locality Search, Profile ID Search, SimplyMarry, Marriage, Matrimonial Sites, Match Making - India Matrimonials
Body:
Matrimony-Telugu Matrimonial | Indian Matrimonial Site | Matrimonial Search | Eenadu Pellipandiri
inputinputinputinput
About Us
Online Matrimony Service From
Pellipandiri Branches
8008928686
040 - 49051234
support@eenadupellipandiri.net
Welcome Guest -Register Now Login to View Suitable Profiles
Register Now
Login
Home Packages Branches
Home
Search
By Profile IDStar RaasiBy ProfessionBy City StateBy Annual IncomeBy EducationBy CommunityAdvance Search
Events
Special Packages
Pellipandiri Branches
Take a Tour
Help
FAQCustomer CareFeedbackSafety / Fraud Alert TipsContact Us
Follow us on:
Previous
Next
Recent Profiles
Next
EP25412630yrs,Kamma,ExecutiveEP25932825yrs,Padmasali,ArmyEP25947933yrs,Kamma,Software DeEP26038927yrs,SC,Not workingEP25934428yrs,Nakkala,Self employEP25671325yrs,Reddy,EngineerEP25765132yrs,Yerukulas,BankerEP26065126yrs,Brahmin,Purohit
Quick Search
Age
To
Religion
- SELECT - HINDUMUSLIMCHRISTIAN
Caste
- SELECT -
Denomination
- SELECT -
ADVENTISTANGLICANEPISCOPALAPOSTOLICASSYRIANASSEMBLY OF GOD (AG)BAPTISTBORN AGAINBRETHRENCALVINISTCATHOLICCHURCH OF GODCHURCH OF SOUTH INDIA (CSI)CHURCH OF CHRISTCONGREGATIONALEVANGELICALJACOBITEJEHOVAH'S WITNESSESJEWISHLATIN CATHOLICLATTER DAY SAINTSLUTHERANMALANKARAMARTHOMAMELKITEMENNONITEMETHODISTMORAVIANORTHODOXPENTECOSTALPROTESTANTPRESBYTERIANSEVENTH-DAY ADVENTISTSYRO MALABARSYRIAN CATHOLICANY
Go
Profile-ID
Go
choose your packages
Regular Packages
Parichaya Vedika Packages
Personalized Packages
upcoming events
Previous
Next
Participate in event
success stories
Angina Prathima 'weds' Srikanth AndeThank You Eenadu Pellipandiri For Ur Good Service
Angina Prathima (ID:EP233977)
Srikanth Ande (ID:EP225582)
Read more
share your success story
Surepally Srija 'weds' Santhosh Kumar KThanks Eenadu Pellipandiri For Your Support In Search Of Life Partner
Surepally Srija (ID:EP231864)
Santhosh Kumar K (ID:EP232249)
Read more
share your success story
Sake Kavya Sri 'weds' B.amarnathWe Participated In Valmiki Boya Parichaya Vedika And Marriage Date Is 24.11.2017 Thank U Eenadu Pellipandiri For Giving Good Service
Sake Kavya Sri (ID:EP232878)
B.amarnath (ID:EP232851)
Read more
share your success story
Name
Missing: Invalid Name
Registered By
- SELECT -
SELFPARENTSSIBLINGSRELATIVESFRIENDSOFFLINE
Missing: Invalid Registered by
Emp Id
Missing: Invalid Emp ID
Emp Name
Missing: Invalid Emp Name
Remarks
Missing: Invalid Remarks
Gender
Male
Female
Missing: Invalid Gender
Dob
DD
12345678910111213141516171819202122232425262728293031
MM
JANUARYFEBURARYMARCHAPRILMAYJUNEJULYAUGUSTSEPTEMBEROCTOBERNOVEMBERDECEMBER
YY
Missing: Invalid DOB
Religion
- SELECT -
HINDUMUSLIMCHRISTIAN
Missing: Invalid Religion
Denomination
- SELECT -
ADVENTISTANGLICANEPISCOPALAPOSTOLICASSYRIANASSEMBLY OF GOD (AG)BAPTISTBORN AGAINBRETHRENCALVINISTCATHOLICCHURCH OF GODCHURCH OF SOUTH INDIA (CSI)CHURCH OF CHRISTCONGREGATIONALEVANGELICALJACOBITEJEHOVAH'S WITNESSESJEWISHLATIN CATHOLICLATTER DAY SAINTSLUTHERANMALANKARAMARTHOMAMELKITEMENNONITEMETHODISTMORAVIANORTHODOXPENTECOSTALPROTESTANTPRESBYTERIANSEVENTH-DAY ADVENTISTSYRO MALABARSYRIAN CATHOLIC
Missing: Invalid Denomination
Caste
- SELECT -
Missing: Invalid Caste
Mother Tongue
- SELECT -
TELUGUHINDIENGLISHARUNACHALIASSAMESEBENGALIGUJARATIHARYANVIHIMACHALI/PAHARIKANNADAKASHMIRIMALAYMALAYALAMMARATHIMARWARINEPALIORIYAPUNJABIRAJASTHANISANSKRITTAMILURDU
Missing: Invalid Mother tongue
Education
- SELECT -
BACHELORSMASTERS DOCTORATEDIPLOMAUNDERGRADUATEHIGH SCHOOLLESS THAN HIGH SCHOOL
Missing: Invalid Education
Mobile
Missing: Invalid Mobile
* Profiles Registered with this Mobile
Email
Missing: Invalid Email
* Profiles Registered with this Email
**
Registration Benefits
input
Your browser does not support the video tag.
video

parichaya vedika photos

head
times;
FREE REGISTRATION BENEFITS
You can view profiles from all over the world.
We have thousands of profiles in our website.
Matching profiles will be sent to your email id to pursue.
You can send 鈥淓xpress Interest鈥 to matching profile via SMS and Email.
Paid members can contact you directly.
Profiles available in our website are trustworthy. Contact numbers are verified and complete profile screening happens before activation.
For us, Customer Security is more important. To avoid frauds, we collect ID Proof as per guidance of INDIAN Govt IT Act and keep them confidential.
Every month community based Parichaya Vedika events are conducted. You can register by paying reasonable amount.
Any information regarding your registration, time to time SMS will be sent to you.
You can visit any of our 28 branches for personal assistance.
About Us
Advanced Search
Contact Us
Feedback
Customer Support
Disclaimer
Site Map
Terms and conditions
Privacy Policy
Declaration : This site is strictly for matrimonial purpose only and not a dating website and should not be used for posting any obscene material.
Tags :Telugu Matrimonial, Indian Matrimonial, Indian Matrimonial Site, Telugu Matrimonials, Indian Matrimonial site, Telugu Matrimonial India, Free Matrimonials, Free Indian Matrimonial, Online Telugu Matrimonial
Copyright 漏 2018 eenadupellipandiri.net. Powered By Margadarsi Computers

times;
LOGIN
Please Wait, While Checking...
Please Wait, While Redirecting...
Error, Please Enter Valid Details.
New member? Register Here
Forgot Your Id, Password? Click Here
Enquiry


Updated Time

Updating   
Friend links: ProxyFire    More...
Site Map 1 2 3 4 5 6 7 8 9 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 250 300 350 400 450 500 550 600 610 620 630 640 650 660 670 680 690 700 710 720 730 740 750
TOS | Contact us
© 2009 MyIP.cn Dev by MYIP Elapsed:58.644ms